ITM1 monoclonal antibody (M02), clone 4D4
  • ITM1 monoclonal antibody (M02), clone 4D4

ITM1 monoclonal antibody (M02), clone 4D4

Ref: AB-H00003703-M02
ITM1 monoclonal antibody (M02), clone 4D4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITM1.
Información adicional
Size 100 ug
Gene Name STT3A
Gene Alias FLJ27038|ITM1|MGC9042|STT3-A|TMC
Gene Description STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITM1 (NP_689926, 603 a.a. ~ 701 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3703
Clone Number 4D4
Iso type IgG1 Kappa

Enviar uma mensagem


ITM1 monoclonal antibody (M02), clone 4D4

ITM1 monoclonal antibody (M02), clone 4D4