ITM1 polyclonal antibody (A01)
  • ITM1 polyclonal antibody (A01)

ITM1 polyclonal antibody (A01)

Ref: AB-H00003703-A01
ITM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITM1.
Información adicional
Size 50 uL
Gene Name STT3A
Gene Alias FLJ27038|ITM1|MGC9042|STT3-A|TMC
Gene Description STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITM1 (NP_689926, 603 a.a. ~ 701 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3703

Enviar uma mensagem


ITM1 polyclonal antibody (A01)

ITM1 polyclonal antibody (A01)