ITK MaxPab mouse polyclonal antibody (B01P)
  • ITK MaxPab mouse polyclonal antibody (B01P)

ITK MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003702-B01P
ITK MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ITK protein.
Información adicional
Size 50 ug
Gene Name ITK
Gene Alias EMT|LYK|MGC126257|MGC126258|PSCTK2
Gene Description IL2-inducible T-cell kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNNFILLEEQLIKKSQQKRRTSPSNFKVRFFVLTKASLAYFEDRHGKKRTLKGSIELSRIKCVEIVKSDISIPCHYKYPFQVVHDNYLLYVFAPDRESRQRWVLALKEETRNNNSLVPKYHPNFWMDGKWRCCSQLEKLATGCAQYDPTKNASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITK (AAI09078.1, 1 a.a. ~ 620 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3702

Enviar uma mensagem


ITK MaxPab mouse polyclonal antibody (B01P)

ITK MaxPab mouse polyclonal antibody (B01P)