ITIH1 purified MaxPab rabbit polyclonal antibody (D01P)
  • ITIH1 purified MaxPab rabbit polyclonal antibody (D01P)

ITIH1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003697-D01P
ITIH1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ITIH1 protein.
Información adicional
Size 100 ug
Gene Name ITIH1
Gene Alias H1P|IATIH|ITIH|MGC126415
Gene Description inter-alpha (globulin) inhibitor H1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDGAMGPRGLLLCMYLVSLLILQAMPALGSATGRSKSSEKRQAVDTAVDGVFIRSLKVNCKVTSRFAHYVVTSQVVNTANEAREVAFDLEIPKTAFISDFAVTADGNAFIGDIKDKVTAWKQYRKAAISGENAGLVRASGRTMEQFTIHLTVNPQSKVTFQLTYEEVLKRNHMQYEIVIKVKPKQLVHHFEIDVDIFEPQGISKLDAQASFLPKELAAQTIKKSFSGKKGHVLFRPTVSQQQSCPTCSTSLLNGH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITIH1 (NP_002206.1, 1 a.a. ~ 911 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3697

Enviar uma mensagem


ITIH1 purified MaxPab rabbit polyclonal antibody (D01P)

ITIH1 purified MaxPab rabbit polyclonal antibody (D01P)