ITGB8 monoclonal antibody (M01), clone 2B4
  • ITGB8 monoclonal antibody (M01), clone 2B4

ITGB8 monoclonal antibody (M01), clone 2B4

Ref: AB-H00003696-M01
ITGB8 monoclonal antibody (M01), clone 2B4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGB8.
Información adicional
Size 100 ug
Gene Name ITGB8
Gene Alias -
Gene Description integrin, beta 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq VENQVQGIYFNITAICPDGSRKPGMEGCRNVTSNDEVLFNVTVTMKKCDVTGGKNYAIIKPIGFNETAKIHIHRNCSCQCEDNRGPKGKCVDETFLDSKCFQCDENKCHFDE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB8 (NP_002205, 392 a.a. ~ 503 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3696
Clone Number 2B4
Iso type IgG1 Kappa

Enviar uma mensagem


ITGB8 monoclonal antibody (M01), clone 2B4

ITGB8 monoclonal antibody (M01), clone 2B4