ITGB6 MaxPab rabbit polyclonal antibody (D01)
  • ITGB6 MaxPab rabbit polyclonal antibody (D01)

ITGB6 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003694-D01
ITGB6 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ITGB6 protein.
Información adicional
Size 100 uL
Gene Name ITGB6
Gene Alias -
Gene Description integrin, beta 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGB6 (NP_000879.2, 1 a.a. ~ 788 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3694

Enviar uma mensagem


ITGB6 MaxPab rabbit polyclonal antibody (D01)

ITGB6 MaxPab rabbit polyclonal antibody (D01)