ITGB5 monoclonal antibody (M01), clone 2C4
  • ITGB5 monoclonal antibody (M01), clone 2C4

ITGB5 monoclonal antibody (M01), clone 2C4

Ref: AB-H00003693-M01
ITGB5 monoclonal antibody (M01), clone 2C4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGB5.
Información adicional
Size 100 ug
Gene Name ITGB5
Gene Alias FLJ26658
Gene Description integrin, beta 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECSPGYLGTRCECQDGENQSVYQNLCREA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB5 (NP_002204, 421 a.a. ~ 516 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3693
Clone Number 2C4
Iso type IgG1 Kappa

Enviar uma mensagem


ITGB5 monoclonal antibody (M01), clone 2C4

ITGB5 monoclonal antibody (M01), clone 2C4