ITGB5 purified MaxPab rabbit polyclonal antibody (D01P)
  • ITGB5 purified MaxPab rabbit polyclonal antibody (D01P)

ITGB5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003693-D01P
ITGB5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ITGB5 protein.
Información adicional
Size 100 ug
Gene Name ITGB5
Gene Alias FLJ26658
Gene Description integrin, beta 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANLVKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ITGB5 (NP_002204.2, 1 a.a. ~ 799 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3693

Enviar uma mensagem


ITGB5 purified MaxPab rabbit polyclonal antibody (D01P)

ITGB5 purified MaxPab rabbit polyclonal antibody (D01P)