ITGB4BP polyclonal antibody (A01)
  • ITGB4BP polyclonal antibody (A01)

ITGB4BP polyclonal antibody (A01)

Ref: AB-H00003692-A01
ITGB4BP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGB4BP.
Información adicional
Size 50 uL
Gene Name EIF6
Gene Alias 2|CAB|EIF3A|ITGB4BP|b|b(2)gcn|gcn|p27BBP
Gene Description eukaryotic translation initiation factor 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq VLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGB4BP (NP_002203, 146 a.a. ~ 245 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3692

Enviar uma mensagem


ITGB4BP polyclonal antibody (A01)

ITGB4BP polyclonal antibody (A01)