ITGAM monoclonal antibody (M07), clone 4E10
  • ITGAM monoclonal antibody (M07), clone 4E10

ITGAM monoclonal antibody (M07), clone 4E10

Ref: AB-H00003684-M07
ITGAM monoclonal antibody (M07), clone 4E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGAM.
Información adicional
Size 100 ug
Gene Name ITGAM
Gene Alias CD11B|CR3A|MAC-1|MAC1A|MGC117044|MO1A|SLEB6
Gene Description integrin, alpha M (complement component 3 receptor 3 subunit)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGAM (NP_000623, 111 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3684
Clone Number 4E10
Iso type IgG1 Kappa

Enviar uma mensagem


ITGAM monoclonal antibody (M07), clone 4E10

ITGAM monoclonal antibody (M07), clone 4E10