ITGAE polyclonal antibody (A01)
  • ITGAE polyclonal antibody (A01)

ITGAE polyclonal antibody (A01)

Ref: AB-H00003682-A01
ITGAE polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGAE.
Información adicional
Size 50 uL
Gene Name ITGAE
Gene Alias CD103|HUMINAE|MGC141996
Gene Description integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGAE (NP_002199, 57 a.a. ~ 171 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3682

Enviar uma mensagem


ITGAE polyclonal antibody (A01)

ITGAE polyclonal antibody (A01)