ITGA7 polyclonal antibody (A01)
  • ITGA7 polyclonal antibody (A01)

ITGA7 polyclonal antibody (A01)

Ref: AB-H00003679-A01
ITGA7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGA7.
Información adicional
Size 50 uL
Gene Name ITGA7
Gene Alias FLJ25220
Gene Description integrin, alpha 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA7 (NP_002197, 478 a.a. ~ 577 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3679

Enviar uma mensagem


ITGA7 polyclonal antibody (A01)

ITGA7 polyclonal antibody (A01)