ITGA4 monoclonal antibody (M02), clone 2G10
  • ITGA4 monoclonal antibody (M02), clone 2G10

ITGA4 monoclonal antibody (M02), clone 2G10

Ref: AB-H00003676-M02
ITGA4 monoclonal antibody (M02), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ITGA4.
Información adicional
Size 50 ug
Gene Name ITGA4
Gene Alias CD49D|IA4|MGC90518
Gene Description integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA,IF
Immunogen Prot. Seq RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA4 (NP_000876, 98 a.a. ~ 207 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3676
Clone Number 2G10
Iso type IgG1 Kappa

Enviar uma mensagem


ITGA4 monoclonal antibody (M02), clone 2G10

ITGA4 monoclonal antibody (M02), clone 2G10