ITGA4 polyclonal antibody (A01)
  • ITGA4 polyclonal antibody (A01)

ITGA4 polyclonal antibody (A01)

Ref: AB-H00003676-A01
ITGA4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGA4.
Información adicional
Size 50 uL
Gene Name ITGA4
Gene Alias CD49D|IA4|MGC90518
Gene Description integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA4 (NP_000876, 98 a.a. ~ 207 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3676

Enviar uma mensagem


ITGA4 polyclonal antibody (A01)

ITGA4 polyclonal antibody (A01)