ISLR purified MaxPab rabbit polyclonal antibody (D01P)
  • ISLR purified MaxPab rabbit polyclonal antibody (D01P)

ISLR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003671-D01P
ISLR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ISLR protein.
Información adicional
Size 100 ug
Gene Name ISLR
Gene Alias HsT17563|MGC102816
Gene Description immunoglobulin superfamily containing leucine-rich repeat
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQELHLLWWALLLGLAQACPEPCDCGEKYGFQIADCAYRDLESVPPGFPANVTTLSLSANRLPGLPEGAFREVPLLQSLWLAHNEIRTVAAGALASLSHLKSLDLSHNLISDFAWSDLHNLSALQLLKMDSNELTFIPRDAFRSLRALRSLQLNHNRLHTLAEGTFTPLTALSHLQINENPFDCTCGIVWLKTWALTTAVSIPEQDNIACTSPHVLKGTPLSRLPPLPCSAPSVQLSYQPSQDGAELRPGFVLAL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ISLR (ABW03309.1, 1 a.a. ~ 428 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3671

Enviar uma mensagem


ISLR purified MaxPab rabbit polyclonal antibody (D01P)

ISLR purified MaxPab rabbit polyclonal antibody (D01P)