IRF5 purified MaxPab rabbit polyclonal antibody (D01P)
  • IRF5 purified MaxPab rabbit polyclonal antibody (D01P)

IRF5 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003663-D01P
IRF5 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IRF5 protein.
Información adicional
Size 100 ug
Gene Name IRF5
Gene Alias SLEB10
Gene Description interferon regulatory factor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MNQSIPVAPTPPRRVRLKPWLVAQVNSCQYPGLQWVNGEKKLFCIPWRHATRHGPSQDGDNTIFKAWAKETGKYTEGVDEADPAKWKANLRCALNKSRDFRLIYDGPRDMPPQPYKIYEVCSNGPAPTDSQPPEDYSFGAGEEEEEEEELQRMLPSLSLTEDVKWPPTLQPPTLRPPTLQPPTLQPPVVLGPPAPDPSPLAPPPGNPAGFRELLSEVLEPGPLPASLPPAGEQLLPDLLISPHMLPLTDLEIKFQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRF5 (NP_116032.1, 1 a.a. ~ 498 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3663

Enviar uma mensagem


IRF5 purified MaxPab rabbit polyclonal antibody (D01P)

IRF5 purified MaxPab rabbit polyclonal antibody (D01P)