IRF3 MaxPab rabbit polyclonal antibody (D01)
  • IRF3 MaxPab rabbit polyclonal antibody (D01)

IRF3 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003661-D01
IRF3 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IRF3 protein.
Información adicional
Size 100 uL
Gene Name IRF3
Gene Alias -
Gene Description interferon regulatory factor 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MGTPKPRILPWLVSQLDLGQLEGVAWVNKSRTRFRIPWKHGLRQDAQQEDFGIFQAWAEATGAYVPGRDKPDLPTWKRNFRSALNRKEGLRLAEDRSKDPHDPHKIYEFVNSGVGDFSQPDTSPDTNGGGSTSDTQEDILDELLGNMVLAPLPDPGPPSLAVAPEPCPQPLRSPSLDNPTPFPNLGPSENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTLPDPGMSLTDR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRF3 (NP_001562.1, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3661

Enviar uma mensagem


IRF3 MaxPab rabbit polyclonal antibody (D01)

IRF3 MaxPab rabbit polyclonal antibody (D01)