IRF2 monoclonal antibody (M04), clone 7C2
  • IRF2 monoclonal antibody (M04), clone 7C2

IRF2 monoclonal antibody (M04), clone 7C2

Ref: AB-H00003660-M04
IRF2 monoclonal antibody (M04), clone 7C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IRF2.
Información adicional
Size 100 ug
Gene Name IRF2
Gene Alias DKFZp686F0244|IRF-2
Gene Description interferon regulatory factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq MSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRF2 (NP_002190, 216 a.a. ~ 315 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3660
Clone Number 7C2
Iso type IgG2a Kappa

Enviar uma mensagem


IRF2 monoclonal antibody (M04), clone 7C2

IRF2 monoclonal antibody (M04), clone 7C2