IRF2 purified MaxPab mouse polyclonal antibody (B01P)
  • IRF2 purified MaxPab mouse polyclonal antibody (B01P)

IRF2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003660-B01P
IRF2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IRF2 protein.
Información adicional
Size 50 ug
Gene Name IRF2
Gene Alias DKFZp686F0244|IRF-2
Gene Description interferon regulatory factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRF2 (AAH15803.1, 1 a.a. ~ 349 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3660

Enviar uma mensagem


IRF2 purified MaxPab mouse polyclonal antibody (B01P)

IRF2 purified MaxPab mouse polyclonal antibody (B01P)