IRF1 MaxPab rabbit polyclonal antibody (D01)
  • IRF1 MaxPab rabbit polyclonal antibody (D01)

IRF1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003659-D01
IRF1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IRF1 protein.
Información adicional
Size 100 uL
Gene Name IRF1
Gene Alias IRF-1|MAR
Gene Description interferon regulatory factor 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRF1 (NP_002189.1, 1 a.a. ~ 325 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3659

Enviar uma mensagem


IRF1 MaxPab rabbit polyclonal antibody (D01)

IRF1 MaxPab rabbit polyclonal antibody (D01)