IRAK2 monoclonal antibody (M04), clone 1A6
  • IRAK2 monoclonal antibody (M04), clone 1A6

IRAK2 monoclonal antibody (M04), clone 1A6

Ref: AB-H00003656-M04
IRAK2 monoclonal antibody (M04), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IRAK2.
Información adicional
Size 100 ug
Gene Name IRAK2
Gene Alias IRAK-2|MGC150550
Gene Description interleukin-1 receptor-associated kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq KPEKPLAASVRKAEDEQEEGQPVRMATFPGPGSSPARAHQPAFLQPPEEDAPHSLRSDLPTSSDSKDFSTSIPKQEKLLSLAGDSLFWSEADVVQATDDF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IRAK2 (NP_001561, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3656
Clone Number 1A6
Iso type IgG1 Kappa

Enviar uma mensagem


IRAK2 monoclonal antibody (M04), clone 1A6

IRAK2 monoclonal antibody (M04), clone 1A6