ITGA6 polyclonal antibody (A01)
  • ITGA6 polyclonal antibody (A01)

ITGA6 polyclonal antibody (A01)

Ref: AB-H00003655-A01
ITGA6 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ITGA6.
Información adicional
Size 50 uL
Gene Name ITGA6
Gene Alias CD49f|DKFZp686J01244|FLJ18737|ITGA6B|VLA-6
Gene Description integrin, alpha 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq FNLDTREDNVIRKYGDPGSLFGFSLAMHWQLQPEDKRLLLVGAPRAEALPLQRANRTGGLYSCDITARGPCTRIEFDNDADPTSESKEDQWMGVTVQSQGPGGKVVTCAH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ITGA6 (NP_000201, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3655

Enviar uma mensagem


ITGA6 polyclonal antibody (A01)

ITGA6 polyclonal antibody (A01)