IRAK1 purified MaxPab mouse polyclonal antibody (B01P)
  • IRAK1 purified MaxPab mouse polyclonal antibody (B01P)

IRAK1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003654-B01P
IRAK1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IRAK1 protein.
Información adicional
Size 50 ug
Gene Name IRAK1
Gene Alias IRAK|pelle
Gene Description interleukin-1 receptor-associated kinase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGGPGPGEPAAPGAQHFLYEVPPWVMCRFYKVMDALEPADWCQFAALIVRDQTELRLCERSGQRTASVLWPWINRNARVADLVHILTHLQLLRARDIITAWHPPAPLPSPGTTAPRPSSIPAPAEAEAWSPRKLPSSASTFLSPAFPGSQTHSGPELGLVPSPASLWPPPPSPAPSSTKPGPESSVSLLQGARPSPFCWPLCEISRGTHNFSEELKIGEGGFGCVYRAVMRNTVYAVKRLKENADLEWTAVKQS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IRAK1 (AAH14963.1, 1 a.a. ~ 633 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3654

Enviar uma mensagem


IRAK1 purified MaxPab mouse polyclonal antibody (B01P)

IRAK1 purified MaxPab mouse polyclonal antibody (B01P)