IPP monoclonal antibody (M01), clone 4C2
  • IPP monoclonal antibody (M01), clone 4C2

IPP monoclonal antibody (M01), clone 4C2

Ref: AB-H00003652-M01
IPP monoclonal antibody (M01), clone 4C2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IPP.
Información adicional
Size 100 ug
Gene Name IPP
Gene Alias KLHL27
Gene Description intracisternal A particle-promoted polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq NNVQELIIAADMLQLTEVVHLCCEFLKGQIDPLNCIGIFQFSEQIACHDLLEFSENYIHVHFLEVHSGEEFLALTKDQLIKILRSEELSIEDEYQVFLAA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IPP (NP_005888.1, 105 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3652
Clone Number 4C2
Iso type IgG2b Kappa

Enviar uma mensagem


IPP monoclonal antibody (M01), clone 4C2

IPP monoclonal antibody (M01), clone 4C2