INPPL1 monoclonal antibody (M02), clone 10G6
  • INPPL1 monoclonal antibody (M02), clone 10G6

INPPL1 monoclonal antibody (M02), clone 10G6

Ref: AB-H00003636-M02
INPPL1 monoclonal antibody (M02), clone 10G6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant INPPL1.
Información adicional
Size 100 ug
Gene Name INPPL1
Gene Alias SHIP2
Gene Description inositol polyphosphate phosphatase-like 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INPPL1 (NP_001558, 1159 a.a. ~ 1258 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3636
Clone Number 10G6
Iso type IgG1 Kappa

Enviar uma mensagem


INPPL1 monoclonal antibody (M02), clone 10G6

INPPL1 monoclonal antibody (M02), clone 10G6