INPP5B purified MaxPab rabbit polyclonal antibody (D01P)
  • INPP5B purified MaxPab rabbit polyclonal antibody (D01P)

INPP5B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003633-D01P
INPP5B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human INPP5B protein.
Información adicional
Size 100 ug
Gene Name INPP5B
Gene Alias 5PTase|MGC65156|MGC71303
Gene Description inositol polyphosphate-5-phosphatase, 75kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MDQSVAIQETLAEGEYCVIAVQGVLCEGDSRQSRLLGLVRYRLEHGGQEHALFLYTHRRMAITGDDVSLDQIVPVSRDFTLEEVSPDGELYILGSDVTVQLDTAELSLVFQLPFGSQTRMFLHEVARACPGFDSATRDPEFLWLSRYRCAELELEMPTPRGCNSALVTWPGYATIGGGGSNFDGLRPNGKGVPMDQSSRGQDKPESLQPRQNKSKSEITDMVRSSTITVSDKAHILSMQKFGLRDTIVKSHLLQK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen INPP5B (AAH58932.1, 1 a.a. ~ 748 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3633

Enviar uma mensagem


INPP5B purified MaxPab rabbit polyclonal antibody (D01P)

INPP5B purified MaxPab rabbit polyclonal antibody (D01P)