INPP5A purified MaxPab rabbit polyclonal antibody (D01P)
  • INPP5A purified MaxPab rabbit polyclonal antibody (D01P)

INPP5A purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003632-D01P
INPP5A purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human INPP5A protein.
Información adicional
Size 100 ug
Gene Name INPP5A
Gene Alias 5PTASE|DKFZp434A1721|MGC116947|MGC116949
Gene Description inositol polyphosphate-5-phosphatase, 40kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGIRHKALGYVLDRIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen INPP5A (NP_005530.3, 1 a.a. ~ 412 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3632

Enviar uma mensagem


INPP5A purified MaxPab rabbit polyclonal antibody (D01P)

INPP5A purified MaxPab rabbit polyclonal antibody (D01P)