INHA monoclonal antibody (M08), clone 3B7
  • INHA monoclonal antibody (M08), clone 3B7

INHA monoclonal antibody (M08), clone 3B7

Ref: AB-H00003623-M08
INHA monoclonal antibody (M08), clone 3B7

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant INHA.
Información adicional
Size 100 ug
Gene Name INHA
Gene Alias -
Gene Description inhibin, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MVLHLLLFLLLTPQGGHSCQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INHA (AAH06391.1, 1 a.a. ~ 366 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3623
Clone Number 3B7
Iso type IgG2a Kappa

Enviar uma mensagem


INHA monoclonal antibody (M08), clone 3B7

INHA monoclonal antibody (M08), clone 3B7