INHA polyclonal antibody (A01)
  • INHA polyclonal antibody (A01)

INHA polyclonal antibody (A01)

Ref: AB-H00003623-A01
INHA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant INHA.
Información adicional
Size 50 uL
Gene Name INHA
Gene Alias -
Gene Description inhibin, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen INHA (AAH06391, 234 a.a. ~ 333 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3623

Enviar uma mensagem


INHA polyclonal antibody (A01)

INHA polyclonal antibody (A01)