IDO1 monoclonal antibody (M14), clone 1D5
  • IDO1 monoclonal antibody (M14), clone 1D5

IDO1 monoclonal antibody (M14), clone 1D5

Ref: AB-H00003620-M14
IDO1 monoclonal antibody (M14), clone 1D5

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant IDO1.
Información adicional
Size 100 ug
Gene Name IDO1
Gene Alias CD107B|IDO|INDO
Gene Description indoleamine 2,3-dioxygenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Re,ELISA
Immunogen Prot. Seq RNFLCSLESNPSVREFVLSKGDAGLREAYDACVKALVSLRSYHLQIVTKYILIPASQQPKENKTSEDPSKLEAKGTGGTDLMNFLKTVRSTTEKSLLKEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IDO1 (NP_002155, 304 a.a. ~ 403 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3620
Clone Number 1D5
Iso type IgG2a Kappa

Enviar uma mensagem


IDO1 monoclonal antibody (M14), clone 1D5

IDO1 monoclonal antibody (M14), clone 1D5