IDO1 purified MaxPab rabbit polyclonal antibody (D03P)
  • IDO1 purified MaxPab rabbit polyclonal antibody (D03P)

IDO1 purified MaxPab rabbit polyclonal antibody (D03P)

Ref: AB-H00003620-D03P
IDO1 purified MaxPab rabbit polyclonal antibody (D03P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IDO1 protein.
Información adicional
Size 100 ug
Gene Name IDO1
Gene Alias CD107B|IDO|INDO
Gene Description indoleamine 2,3-dioxygenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWED
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IDO1 (AAH27882.1, 1 a.a. ~ 403 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3620

Enviar uma mensagem


IDO1 purified MaxPab rabbit polyclonal antibody (D03P)

IDO1 purified MaxPab rabbit polyclonal antibody (D03P)