IDO1 polyclonal antibody (A01)
  • IDO1 polyclonal antibody (A01)

IDO1 polyclonal antibody (A01)

Ref: AB-H00003620-A01
IDO1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IDO1.
Información adicional
Size 50 uL
Gene Name IDO1
Gene Alias CD107B|IDO|INDO
Gene Description indoleamine 2,3-dioxygenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAHAMENSWTISKEYHIDEEVGFALPNPQENLPDFYNDWMFIAKHLPDLIESGQLRERVEKLNMLSIDHLTDHKSQRLARLVLGCITMAYVWGKGHGDVRKVLPRNIAVPYCQLSKKLELPPILVYADCVLANWKKKDPNKPLTYENMDVLFSFRDGDCSKGFFLVSLLVEIAAASAIKVIPTVFKAMQMQERDTLLKALLEIASCLEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWED
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IDO1 (AAH27882, 1 a.a. ~ 403 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3620

Enviar uma mensagem


IDO1 polyclonal antibody (A01)

IDO1 polyclonal antibody (A01)