IMPDH1 MaxPab rabbit polyclonal antibody (D01)
  • IMPDH1 MaxPab rabbit polyclonal antibody (D01)

IMPDH1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00003614-D01
IMPDH1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IMPDH1 protein.
Información adicional
Size 100 uL
Gene Name IMPDH1
Gene Alias DKFZp781N0678|IMPD|IMPD1|LCA11|RP10|sWSS2608
Gene Description IMP (inosine monophosphate) dehydrogenase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MEGPLTPPPLQGGGAAAVPEPGARQHPGHETAAQRYSARLLQAGYEPESMADYLISGGTGYVPEDGLTAQQLFASADGLTYNDFLILPGFIDFIADEVDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFIHHNCTPEFQANEVRKVKKFEQGFITDPVVLSPSHTVGDVLEAKMRHGFSGIPITETGTMGSKLVGIVTSRDIDFLAEKDHTTLLSEVMTPRIELVVAPAGVTLKEANEILQRSKK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IMPDH1 (NP_899066.1, 1 a.a. ~ 563 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 3614

Enviar uma mensagem


IMPDH1 MaxPab rabbit polyclonal antibody (D01)

IMPDH1 MaxPab rabbit polyclonal antibody (D01)