IMPA2 purified MaxPab rabbit polyclonal antibody (D01P)
  • IMPA2 purified MaxPab rabbit polyclonal antibody (D01P)

IMPA2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003613-D01P
IMPA2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IMPA2 protein.
Información adicional
Size 100 ug
Gene Name IMPA2
Gene Alias -
Gene Description inositol(myo)-1(or 4)-monophosphatase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IMPA2 (NP_055029.1, 1 a.a. ~ 288 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3613

Enviar uma mensagem


IMPA2 purified MaxPab rabbit polyclonal antibody (D01P)

IMPA2 purified MaxPab rabbit polyclonal antibody (D01P)