IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)
  • IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)

IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00003612-D01P
IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IMPA1 protein.
Información adicional
Size 100 ug
Gene Name IMPA1
Gene Alias IMPA
Gene Description inositol(myo)-1(or 4)-monophosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IF
Immunogen Prot. Seq MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IMPA1 (NP_005527.1, 1 a.a. ~ 277 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3612

Enviar uma mensagem


IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)

IMPA1 purified MaxPab rabbit polyclonal antibody (D01P)