IMPA1 polyclonal antibody (A01)
  • IMPA1 polyclonal antibody (A01)

IMPA1 polyclonal antibody (A01)

Ref: AB-H00003612-A01
IMPA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IMPA1.
Información adicional
Size 50 uL
Gene Name IMPA1
Gene Alias IMPA
Gene Description inositol(myo)-1(or 4)-monophosphatase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IMPA1 (AAH08381, 1 a.a. ~ 277 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3612

Enviar uma mensagem


IMPA1 polyclonal antibody (A01)

IMPA1 polyclonal antibody (A01)