ILK monoclonal antibody (M01), clone 4F10
  • ILK monoclonal antibody (M01), clone 4F10

ILK monoclonal antibody (M01), clone 4F10

Ref: AB-H00003611-M01
ILK monoclonal antibody (M01), clone 4F10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ILK.
Información adicional
Size 100 ug
Gene Name ILK
Gene Alias DKFZp686F1765|P59
Gene Description integrin-linked kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ILK (AAH01554, 341 a.a. ~ 452 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3611
Clone Number 4F10
Iso type IgG1 Kappa

Enviar uma mensagem


ILK monoclonal antibody (M01), clone 4F10

ILK monoclonal antibody (M01), clone 4F10