ILK polyclonal antibody (A01)
  • ILK polyclonal antibody (A01)

ILK polyclonal antibody (A01)

Ref: AB-H00003611-A01
ILK polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ILK.
Información adicional
Size 50 uL
Gene Name ILK
Gene Alias DKFZp686F1765|P59
Gene Description integrin-linked kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KFSFQCPGRMYAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHVCKLMKICMNEDPAKRPKFDMIVPILEKMQDK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ILK (AAH01554, 341 a.a. ~ 452 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3611

Enviar uma mensagem


ILK polyclonal antibody (A01)

ILK polyclonal antibody (A01)