IL17A monoclonal antibody (M01), clone 3G5
  • IL17A monoclonal antibody (M01), clone 3G5

IL17A monoclonal antibody (M01), clone 3G5

Ref: AB-H00003605-M01
IL17A monoclonal antibody (M01), clone 3G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL17A.
Información adicional
Size 100 ug
Gene Name IL17A
Gene Alias CTLA8|IL-17|IL-17A|IL17
Gene Description interleukin 17A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL17A (NP_002181.1, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3605
Clone Number 3G5
Iso type IgG2a Kappa

Enviar uma mensagem


IL17A monoclonal antibody (M01), clone 3G5

IL17A monoclonal antibody (M01), clone 3G5