IL15RA polyclonal antibody (A01)
  • IL15RA polyclonal antibody (A01)

IL15RA polyclonal antibody (A01)

Ref: AB-H00003601-A01
IL15RA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL15RA.
Información adicional
Size 50 uL
Gene Name IL15RA
Gene Alias MGC104179
Gene Description interleukin 15 receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ITCPPPMSVEHADIWVKSYSLYSRERYICNSGFKRKAGTSSLTECVLNKATNVAHWTTPSLKCIRDPALVHQRPAPPSTVTTAGVTPQPESLSPSGKEPA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL15RA (NP_002180, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3601

Enviar uma mensagem


IL15RA polyclonal antibody (A01)

IL15RA polyclonal antibody (A01)