IL15 monoclonal antibody (M04), clone 1H8
  • IL15 monoclonal antibody (M04), clone 1H8

IL15 monoclonal antibody (M04), clone 1H8

Ref: AB-H00003600-M04
IL15 monoclonal antibody (M04), clone 1H8

Información del producto

Mouse monoclonal antibody raised against a full length recombinant IL15.
Información adicional
Size 100 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA,IF
Immunogen Prot. Seq NWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL15 (NP_000576, 49 a.a. ~ 162 a.a) full length recombinant protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3600
Clone Number 1H8
Iso type IgG2a Kappa

Enviar uma mensagem


IL15 monoclonal antibody (M04), clone 1H8

IL15 monoclonal antibody (M04), clone 1H8