IL15 monoclonal antibody (M01), clone 1H6
  • IL15 monoclonal antibody (M01), clone 1H6

IL15 monoclonal antibody (M01), clone 1H6

Ref: AB-H00003600-M01
IL15 monoclonal antibody (M01), clone 1H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL15.
Información adicional
Size 100 ug
Gene Name IL15
Gene Alias IL-15|MGC9721
Gene Description interleukin 15
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq GIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL15 (AAH18149, 30 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3600
Clone Number 1H6
Iso type IgG

Enviar uma mensagem


IL15 monoclonal antibody (M01), clone 1H6

IL15 monoclonal antibody (M01), clone 1H6