IL13RA2 monoclonal antibody (M01), clone 2E10
  • IL13RA2 monoclonal antibody (M01), clone 2E10

IL13RA2 monoclonal antibody (M01), clone 2E10

Ref: AB-H00003598-M01
IL13RA2 monoclonal antibody (M01), clone 2E10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL13RA2.
Información adicional
Size 100 ug
Gene Name IL13RA2
Gene Alias CD213A2|IL-13R|IL13BP
Gene Description interleukin 13 receptor, alpha 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab
Immunogen Prot. Seq DTEIKVNPPQDFEIVDPGYLGYLYLQWQPPLSLDHFKECTVEYELKYRNIGSETWKTIITKNLHYKDGFDLNKGIEAKIHTLLPWQCTNGSEVQSSWAET
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL13RA2 (NP_000631, 27 a.a. ~ 126 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3598
Clone Number 2E10
Iso type IgG2a Kappa

Enviar uma mensagem


IL13RA2 monoclonal antibody (M01), clone 2E10

IL13RA2 monoclonal antibody (M01), clone 2E10