IL13RA1 purified MaxPab mouse polyclonal antibody (B01P)
  • IL13RA1 purified MaxPab mouse polyclonal antibody (B01P)

IL13RA1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003597-B01P
IL13RA1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL13RA1 protein.
Información adicional
Size 50 ug
Gene Name IL13RA1
Gene Alias CD213A1|IL-13Ra|NR4
Gene Description interleukin 13 receptor, alpha 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key Flow Cyt,WB-Tr
Immunogen Prot. Seq MEWPARLCGLWALLLCAGGGGGGGGAAPTETQPPVTNLSVSVENLCTVIWTWNPPEGASSNCSLWYFSHFGDKQDKKIAPETRRSIEVPLNERICLQVGSQCSTNESEKPSILVEKCISPPEGDPESAVTELQCIWHNLSYMKCSWLPGRNTSPDTNYTLYYWHRSLEKIHQCENIFREGQYFGCSFDLTKVKDSSFEQHSVQIMVKDNAGKIKPSFNIVPLTSRVKPDPPHIKNLSFHNDDLYVQWENPQNFIS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL13RA1 (NP_001551.1, 1 a.a. ~ 427 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3597

Enviar uma mensagem


IL13RA1 purified MaxPab mouse polyclonal antibody (B01P)

IL13RA1 purified MaxPab mouse polyclonal antibody (B01P)