IL12RB2 monoclonal antibody (M02), clone 2H6
  • IL12RB2 monoclonal antibody (M02), clone 2H6

IL12RB2 monoclonal antibody (M02), clone 2H6

Ref: AB-H00003595-M02
IL12RB2 monoclonal antibody (M02), clone 2H6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL12RB2.
Información adicional
Size 100 ug
Gene Name IL12RB2
Gene Alias -
Gene Description interleukin 12 receptor, beta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL12RB2 (NP_001550, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3595
Clone Number 2H6
Iso type IgG2a Kappa

Enviar uma mensagem


IL12RB2 monoclonal antibody (M02), clone 2H6

IL12RB2 monoclonal antibody (M02), clone 2H6