IL12RB2 purified MaxPab mouse polyclonal antibody (B01P)
  • IL12RB2 purified MaxPab mouse polyclonal antibody (B01P)

IL12RB2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00003595-B01P
IL12RB2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human IL12RB2 protein.
Información adicional
Size 50 ug
Gene Name IL12RB2
Gene Alias -
Gene Description interleukin 12 receptor, beta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAHTFRGCSLAFMFIITWLLIKAKIDACKRGDVTVKPSHVILLGSTVNITCSLKPRQGCFHYSRRNKLILYKFDRRINFHHGHSLNSQVTGLPLGTTLFVCKLACINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPSTFTFLDIVRPLPPWDIRIKFQKASVSRCTLYWRDEGLVLLN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL12RB2 (NP_001550.1, 1 a.a. ~ 862 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3595

Enviar uma mensagem


IL12RB2 purified MaxPab mouse polyclonal antibody (B01P)

IL12RB2 purified MaxPab mouse polyclonal antibody (B01P)