IL12RB2 polyclonal antibody (A01)
  • IL12RB2 polyclonal antibody (A01)

IL12RB2 polyclonal antibody (A01)

Ref: AB-H00003595-A01
IL12RB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant IL12RB2.
Información adicional
Size 50 uL
Gene Name IL12RB2
Gene Alias -
Gene Description interleukin 12 receptor, beta 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq CINSDEIQICGAEIFVGVAPEQPQNLSCIQKGEQGTVACTWERGRDTHLYTEYTLQLSGPKNLTWQKQCKDIYCDYLDFGINLTPESPESNFTAKVTAVNSLGSSSSLPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL12RB2 (NP_001550, 105 a.a. ~ 214 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3595

Enviar uma mensagem


IL12RB2 polyclonal antibody (A01)

IL12RB2 polyclonal antibody (A01)