View larger
Mouse monoclonal antibody raised against a partial recombinant IL12A.
AB-H00003592-M02
New product
IL12A monoclonal antibody (M02), clone 1A6
Ao comprar este produto pode ganhar até 3 pontos de fidelização. Seu carrinho totalizará 3 pontos de fidelização que podem ser convertidos num vale de desconto de 12.00EUR.
Data sheet
| Size | 100 ug |
| Gene Name | IL12A |
| Gene Alias | CLMF|IL-12A|NFSK|NKSF1|P35 |
| Gene Description | interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35) |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,ELISA |
| Immunogen Prot. Seq | CLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | IL12A (NP_000873.2, 144 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 3592 |
| Clone Number | 1A6 |
| Iso type | IgG2b Kappa |
More info
Mouse monoclonal antibody raised against a partial recombinant IL12A.