IL12A monoclonal antibody (M02), clone 1A6
  • IL12A monoclonal antibody (M02), clone 1A6

IL12A monoclonal antibody (M02), clone 1A6

Ref: AB-H00003592-M02
IL12A monoclonal antibody (M02), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL12A.
Información adicional
Size 100 ug
Gene Name IL12A
Gene Alias CLMF|IL-12A|NFSK|NKSF1|P35
Gene Description interleukin 12A (natural killer cell stimulatory factor 1, cytotoxic lymphocyte maturation factor 1, p35)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq CLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL12A (NP_000873.2, 144 a.a. ~ 253 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3592
Clone Number 1A6
Iso type IgG2b Kappa

Enviar uma mensagem


IL12A monoclonal antibody (M02), clone 1A6

IL12A monoclonal antibody (M02), clone 1A6