IL11RA polyclonal antibody (A01)
  • IL11RA polyclonal antibody (A01)

IL11RA polyclonal antibody (A01)

Ref: AB-H00003590-A01
IL11RA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant IL11RA.
Información adicional
Size 50 uL
Gene Name IL11RA
Gene Alias MGC2146
Gene Description interleukin 11 receptor, alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWFRDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICQTLDGALGGTVTLQLGYPPARPVVSCQAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASWTYPASWPCQPHFLLK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL11RA (AAH03110, 1 a.a. ~ 422 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 3590

Enviar uma mensagem


IL11RA polyclonal antibody (A01)

IL11RA polyclonal antibody (A01)