IL11 monoclonal antibody (M17), clone 1F1
  • IL11 monoclonal antibody (M17), clone 1F1

IL11 monoclonal antibody (M17), clone 1F1

Ref: AB-H00003589-M17
IL11 monoclonal antibody (M17), clone 1F1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant IL11.
Información adicional
Size 100 ug
Gene Name IL11
Gene Alias AGIF|IL-11
Gene Description interleukin 11
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen IL11 (NP_000632.1, 25 a.a. ~ 74 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 3589
Clone Number 1F1
Iso type IgG2a Kappa

Enviar uma mensagem


IL11 monoclonal antibody (M17), clone 1F1

IL11 monoclonal antibody (M17), clone 1F1